Sermorelin
CAS 86168-78-7
$49.99 / vial
The first 29 residues of human GHRH as a C-terminal amide.
Certificate of Analysis
Certificate of analysis available on request. [email protected]
Every product is third-party tested by an independent laboratory, and each certificate states the lot that was tested. Include your order number and the product name.
About this compound
Sermorelin
Sermorelin is a synthetic 29-amino-acid peptide corresponding to residues 1–29 of human growth hormone-releasing hormone, the shortest fragment that retains full receptor activity in the literature.
The residues are unmodified and the C-terminus is an amide.
It is used in research on GHRH receptor binding and structure–activity relationships of GHRH fragments.
Supplied for laboratory research use only. Not intended for human or animal administration.
Specifications
| CAS number | 86168-78-7 |
|---|---|
| Molecular formula | C149H246N44O42S |
| Molecular weight | 3357.89 g/mol |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 |
| Appearance | White lyophilized powder |
| Form | Lyophilized powder |
| Sizes | 5mg CENV-SERM-5 |
Storage and handling
Store the sealed vial at −20 °C. Protect from light and moisture. Keep sealed until use.
Handling information covers the sealed vial only. These products are for laboratory research and are not for human or animal use.
Related compounds
GHRH Analogs & Secretagogues
Ipamorelin
From $25.99 / vial Made to orderView This product has multiple variants. The options may be chosen on the product pageMelanocortin Analogs
MT2
From $27.99 / vial Made to orderView This product has multiple variants. The options may be chosen on the product pageGHRH Analogs & Secretagogues
Tesamorelin
From $49.99 / vial Made to orderView This product has multiple variants. The options may be chosen on the product pageMelanocortin Analogs
MT1
From $27.99 / vial Made to orderView This product has multiple variants. The options may be chosen on the product page
